missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. ErbB2/Her2 Antibody, R&D Systems™

ErbB2/Her2 Antibody, R&D Systems™

Artikelnummer. 18476140 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18476140 25 μL -
18420501 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18476140 Leverandør Novus Biologicals Leverandørnr. NBP18458425ul
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ErbB2/Her2 Polyclonal specifically detects ErbB2/Her2 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ErbB2/Her2
Applikationer Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Værtsarter Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Oprensningsmetode Immunogen affinity purified
Mængde 25 μL
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Primær eller sekundær Primary
Gen-id (Entrez) 2064
Målarter Human, Mouse
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.