missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. Endophilin A1/SH3GL2 Antibody, Novus Biologicals™

Endophilin A1/SH3GL2 Antibody, Novus Biologicals™

Artikelnummer. 18198287 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18198287 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18198287 Leverandør Novus Biologicals Leverandørnr. NBP238996

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Endophilin A1/SH3GL2
Applikationer Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genadgangsnr. Q99962
Gene Alias CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1
Gensymboler SH3GL2
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELS
Oprensningsmetode Affinity Purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer
Primær eller sekundær Primary
Gen-id (Entrez) 6456
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.