missing translation for 'onlineSavingsMsg'
Learn More

DUSP9 Antibody (2E3), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00001852-M04

Product Code. 18363788

4605.00 DKK / 0.01mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

DUSP9 Monoclonal antibody specifically detects DUSP9 in Human samples. It is validated for Western Blot, ELISA, Proximity Ligation Assay

Specifications

Antigen	DUSP9
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	dual specificity phosphatase 9, EC 3.1.3.16, EC 3.1.3.48, MAP kinase phosphatase 4, Mitogen-activated protein kinase phosphatase 4, MKP-4dual specificity protein phosphatase 9, MKP4serine/threonine specific protein phosphatase
Immunogen	DUSP9 (NP_001386, 174 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE
Quantity	0.1 mg
Research Discipline	Signal Transduction
Gene ID (Entrez)	1852
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Applications	Western Blot, ELISA, Proximity Ligation Assay
Clone	2E3
Dilution	Western Blot 1:500
Gene Accession No.	NP_001386
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10399053

Invitrogen ™ Countess ™ Cell Counting Chamber Invitrogen ™ Countess ™ Cell Counting Chamber

kr 996,00 / Pack of 50
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

kr 1.528,00 / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mass Spectrometry Grade Pr Thermo Scientific ™ Mass Spectrometry Grade Pr

kr 788,00 / Pack of 5
Catalog No. 10647894

Thermo Scientific ™ 1-Step ™ TMB ELISA Substr Thermo Scientific ™ 1-Step ™ TMB ELISA Substr

kr 2.110,00 / 250mL
Catalog No. 15352644

Invitrogen ™ CellTracker ™ Fluorescent Probes Invitrogen ™ CellTracker ™ Fluorescent Probes

kr 3.205,00 / 300µg
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

kr 1.404,00 / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

kr 1.742,00 / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

kr 5.300,00 / 5mg
Catalog No. 11519816

Gibco ™ Collagen I, rat tail Gibco ™ Collagen I, rat tail

kr 2.685,00 / 20mL
Catalog No. 15137105

Applied Biosystems ™ ProFlex ™ PCR System, 96 Applied Biosystems ™ ProFlex ™ PCR System, 96

kr 86.520,00 / Each
Catalog No. 11514270

Invitrogen ™ Trenbolone Polyclonal Antibody Invitrogen ™ Trenbolone Polyclonal Antibody

kr 6.860,00 / 100µL
Catalog No. 30284729

Invitrogen ™ Trevogrumab Recombinant Monoclona Invitrogen ™ Trevogrumab Recombinant Monoclona

kr 8.980,00 / 1mg

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

DUSP9 Antibody (2E3), Novus Biologicals™ > 0.1 mg, Unconjugated

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

DUSP9 Antibody (2E3), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions