missing translation for 'onlineSavingsMsg'
Få mere at vide

DNAJC19 Antibody [Alexa Fluor« 488], Novus Biologicals Biologicals™

Artikelnummer. 30499033 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30499033 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30499033 Leverandør Novus Biologicals Leverandørnr. NBP338125AF488

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

DNAJC19 Polyclonal antibody specifically detects DNAJC19 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen DNAJC19
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Alexa Fluor 488
Formulering 50mM Sodium Borate
Gene Alias DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).,, Sequence:, MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Vision
Primær eller sekundær Primary
Gen-id (Entrez) 131118
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.