missing translation for 'onlineSavingsMsg'
Få mere at vide

Deoxycytidylate deaminase Antibody, Novus Biologicals™

Artikelnummer. p-7107718 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18216423 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18216423 Leverandør Novus Biologicals Leverandørnr. NBP157825

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Rabbit Polyclonal Antibody

Deoxycytidylate deaminase Polyclonal specifically detects Deoxycytidylate deaminase in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen Deoxycytidylate deaminase
Applikationer Western Blot
Klassifikation Polyclonal
Koncentration 0.5 mg/ml
Konjugeret Unconjugated
Fortynding Western Blot 1.0 ug/ml
Formulering PBS, 2% Sucrose with 0.09% Sodium Azide
Genadgangsnr. D3DP49
Gene Alias dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062
Gensymboler DCTD
Værtsarter Rabbit
Immunogen Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL.
Oprensningsmetode Affinity purified
Mængde 100 μL
Regulatorisk status RUO
Forskningsdisciplin Lipid and Metabolism
Primær eller sekundær Primary
Gen-id (Entrez) 1635
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Målarter Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.