missing translation for 'onlineSavingsMsg'
Få mere at vide

Novus Biologicals™ DEFB107A Recombinant Protein Antigen

Artikelnummer. 18264543 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Protein længde:
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Protein længde unitSize
18264543 EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT -
18277151 QARTAIHRALISKRMEGHCEAECLTFEVKIGGCRAELAP 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18264543 Leverandør Novus Biologicals™ Leverandørnr. NBP259792PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DEFB104A The DEFB104A Recombinant Protein Antigen is derived from E. coli. The DEFB104A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Protein længde EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn DEFB104A Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4
Til brug med (applikation) AC
Gene Alias DEFB104B, DEFB-4, defensin
Gen symbol DEFB104A
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 0.1 mL
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet Human
Vis mere Vis mindre

For Research Use Only.

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.