missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18255234

Novus Biologicals™ DCPS Recombinant Protein Antigen

Artikelnummer. 18255234 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18255234 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18255234 Leverandør Novus Biologicals™ Leverandørnr. NBP256249PEP

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCPS. Source: E.coli Amino Acid Sequence: QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY The DCPS Recombinant Protein Antigen is derived from E. coli. The DCPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gen-id (Entrez) 28960
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn DCPS Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias DCS1, DCS-1, decapping enzyme, scavenger, EC 3.-, heat shock-like protein 1, HINT5, HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, HSL1, HSPC015, mRNA decapping enzyme
Gen symbol DCPS
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μl
Regulatorisk status RUO
Kilde E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52282. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

For Research Use Only.

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.