missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
DAZL Polyclonal antibody specifically detects DAZL in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Tekniske data
Tekniske data
| Antigen | DAZL |
| Applikationer | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | DyLight 550 |
| Formulering | 50mM Sodium Borate |
| Gene Alias | DAZHSPGY-like-autosomal, DAZL1DAZ-like autosomal, DAZLA, deleted in azoospermia-like, Deleted in azoospermia-like 1, germline specific RNA binding protein, MGC26406, spermatogenesis gene on the Y-like autosomal, SPGYLADAZ homolog |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2).,, Sequence:, RSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?