missing translation for 'onlineSavingsMsg'
Få mere at vide

Tocris Bioscience™ [D-Ala2]-GIP (human)
GREENER_CHOICE

Artikelnummer. 18796556
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18796556 1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18796556 Leverandør Tocris Bioscience™ Leverandørnr. 6699/1

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Highly potent GIP agonist

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.
TRUSTED_SUSTAINABILITY

Tekniske data

Renhed 95%
CAS 444073-04-5
Indhold og opbevaring Store at -20°C
Oversigt GIP receptor agonist
Formulering C226H338N60O66S
Molekylvægt (g/mol) 4983.58
Mængde 1 mg
Sekvens YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala)
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.