missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18234689

Novus Biologicals™ Cysteine Conjugate beta-Lyase/CCBL1 Recombinant Protein Antigen

Artikelnummer. 18234689 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0,1 ml
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
18234689 0,1 ml 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18234689 Leverandør Novus Biologicals™ Leverandørnr. NBP183315PEP
 Begrænset vare
Forventet forsendelse: 14-10-2026
Læg i indkøbskurv
Læg i indkøbskurv
Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCBL1. The Cysteine Conjugate beta-Lyase/CCBL1 Recombinant Protein Antigen is derived from E. coli. The Cysteine Conjugate beta-Lyase/CCBL1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-83315. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifikationer

Gen-id (Entrez) 883
Arter Human
Oprensningsmetode Chromatography
Renhed >80%
Koncentration 0.5mg/mL
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gen symbol CCBL1
Etikettype Unlabeled
Molekylvægt (g/mol) 29kDa
Produkttype Cysteine Conjugate beta-Lyase/CCBL1
Mængde 0,1 ml
Regulatorisk status RUO
Kilde E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83315. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.