missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498977

CYP7B1 Antibody [Biotin], Novus Biologicals Biologicals™

Artikelnummer. 30498977 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498977 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498977 Leverandør Novus Biologicals Leverandørnr. NBP335797B

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

CYP7B1 Polyclonal antibody specifically detects CYP7B1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CYP7B1
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret Biotin
Formulering PBS
Gene Alias CBAS3, CP7B, Cytochrome P450 7B1, cytochrome P450, family 7, subfamily B, polypeptide 1, cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1,25-hydroxycholesterol 7-alpha-hydroxylase, EC 1.14.13.100, oxysterol 7alpha-hydroxylase, Oxysterol 7-alpha-hydroxylase, spastic paraplegia 5A (autosomal recessive), SPG5A
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP7B1 (NP_004811.1).,, Sequence:, VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Cardiovascular Biology, Cellular Signaling, metabolism, Neuroscience
Primær eller sekundær Primary
Gen-id (Entrez) 9420
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.