missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CXCL1 (Human) Recombinant Protein (P01)

Human CXCL1 full-length ORF with GST-tag at N-terminal

2735.00 DKK - 4145.00 DKK

Specifications

Accession Number	AAH11976
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	2919
Molecular Weight (g/mol)	37.51

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16125791 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00002919-P01.10ug	10 μg	2735.00 DKK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16135791 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00002919-P01.25ug	25 μg	4145.00 DKK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal

Theoretical MW: 37.51kDa
Preparation Method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

Accession Number	AAH11976
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	37.51
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	CXCL1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	2919
Name	CXCL1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Gene Alias	FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1
Gene Symbol	CXCL1
Species	Wheat Germ (in vitro)
Protein Tag	GST

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ CXCL1 (Human) Recombinant Protein (P01)

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ CXCL1 (Human) Recombinant Protein (P01)

Specifications

Description

Specifications

Documents