missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CXCL1 (Human) Recombinant Protein (P01)
Human CXCL1 full-length ORF with GST-tag at N-terminal
Brand: Abnova™ H00002919-P01.25ug
Additional Details : Weight : 0.00010kg
Description
Human CXCL1 full-length ORF ( AAH11976, 1 a.a. - 107 a.a.) recombinant protein with GST-tag at N-terminal
- Theoretical MW: 37.51kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
| AAH11976 | |
| Solution | |
| 2919 | |
| CXCL1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CXCL1 | |
| Human | |
| Yes |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 37.51 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN | |
| FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1 | |
| CXCL1 | |
| Wheat Germ (in vitro) | |
| GST |