missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ CRX/CORD2 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-88060PEP

Additional Details : Weight : 0.00970kg

Product Code. 18310531

  • 1842.28 DKK / 0.10mL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CRX. The CRX/CORD2 Recombinant Protein Antigen is derived from E. coli. The CRX/CORD2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-88060. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Specifications

1406
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
CRX
28kDa
0.1mL
E.Coli
PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
CRX/CORD2
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88060. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

For Research Use Only