missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
CPT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
1590.00 DKK - 4345.00 DKK
Tekniske data
| Antigen | CPT2 |
|---|---|
| Fortynding | Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applikationer | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Mængde | Pris | Antal & tilgængelighed | |||||
|
30231535
|
Novus Biologicals
NBP3-38018-100ul |
100 μL |
4345.00 DKK
100µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
|
30229809
|
Novus Biologicals
NBP3-38018-20ul |
20 μL |
1590.00 DKK
20µL |
Venligst log indfor at købe denne vare. Brug for en webkonto? Register dig hos os i dag! | |||||
Beskrivelse
CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Tekniske data
| CPT2 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 1376 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE | |
| A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel