missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. CD8 Antibody (CL1529), R&D Systems™

CD8 Antibody (CL1529), R&D Systems™

Artikelnummer. 18608625 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18608625 25 μL
18173519 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18608625 Leverandør Novus Biologicals Leverandørnr. NBP23674325ul
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen CD8
Applikationer Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon CL1529
Konjugeret Unconjugated
Fortynding Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genadgangsnr. P01732
Gene Alias CD8, CD8a molecule, LEU2, p32
Gensymboler CD8A
Værtsarter Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Oprensningsmetode Protein A purified
Mængde 25 μL
Regulatorisk status RUO
Forskningsdisciplin Innate Immunity
Primær eller sekundær Primary
Gen-id (Entrez) 925
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Rekonstitution Protein A purified
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG1
Produktlinje Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.