missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CD3Z Recombinant Protein
Human CD3Z full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00000919-P01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Theoretical MW (kDa): 43.78
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH25703 | |
| Solution | |
| 919 | |
| CD3Z (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD247 | |
| Human | |
| Yes |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 43.78 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR | |
| CD3-ZETA/CD3H/CD3Q/CD3Z/T3Z/TCRZ | |
| CD247 | |
| Wheat Germ (in vitro) | |
| GST |