missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. CCR7 Antibody, R&D Systems™

CCR7 Antibody, R&D Systems™

Product Code. 18611599 Shop All Bio Techne Products
Change view
Click to view available options
Mængde:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Mængde
18611599 25 μL
18224192 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18611599 Supplier Novus Biologicals Supplier No. NBP25875325ul
 Begrænset vare
Forventet forsendelse: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

CCR7 Polyclonal specifically detects CCR7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Single Cell Western.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CCR7
Applikationer Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulering PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias BLR2C-C chemokine receptor type 7, C-C CKR-7, CC-CKR-7, CCR-7, CD197, CD197 antigen, CDw197CC chemokine receptor 7, chemokine (C-C motif) receptor 7, CMKBR7chemokine (C-C) receptor 7, EBI1EBV-induced G protein-coupled receptor 1, EBV-induced G-protein coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus induced G-protein coupled receptor, Epstein-Barr virus-induced G-protein coupled receptor 1, EVI1, lymphocyte-specific G protein-coupled peptide receptor, MIP-3 beta receptor
Gensymboler CCR7
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS
Oprensningsmetode Affinity Purified
Mængde 25 μL
Regulatorisk status RUO
Forskningsdisciplin Chemokines and Cytokines, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
Primær eller sekundær Primary
Gen-id (Entrez) 1236
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.