missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Description
CACNG1 Polyclonal antibody specifically detects CACNG1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | CACNG1 |
| Applikationer | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugeret | PE |
| Formulering | PBS |
| Gene Alias | CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma, calcium channel, voltage-dependent, gamma subunit 1, L-type calcium channel gamma polypeptide, neuronal dihydropyridine-sensitive calcium channel gamma subunit, voltage-dependent calcium channel gamma-1 subunit |
| Værtsarter | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1).,, Sequence:, DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
| Oprensningsmetode | Affinity purified |
| Mængde | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?