missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498862

CACNG1 Antibody [PE], Novus Biologicals Biologicals™

Artikelnummer. 30498862 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498862 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498862 Leverandør Novus Biologicals Leverandørnr. NBP335094PE

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CACNG1 Polyclonal antibody specifically detects CACNG1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CACNG1
Applikationer ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugeret PE
Formulering PBS
Gene Alias CACNLGDihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma, calcium channel, voltage-dependent, gamma subunit 1, L-type calcium channel gamma polypeptide, neuronal dihydropyridine-sensitive calcium channel gamma subunit, voltage-dependent calcium channel gamma-1 subunit
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1).,, Sequence:, DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 786
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.