missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BTD Recombinant Protein

Human BTD full-length ORF recombinant protein with GST-tag at N-terminal

2735.00 DKK - 4040.00 DKK

Specifications

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	85.47
pH Range	8
Preparation Method	In vitro wheat germ expression system

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16132371 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00000686-P01.10ug	10 μg	2735.00 DKK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16142371 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00000686-P01.25ug	25 μg	4040.00 DKK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

Biotinidase functions to recycle biotin in the body by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. Biotinidase has also been shown to have biotinyl-transferase activity. Defects in the biotinidase gene cause multiple carboxylase deficiency.

Theoretical MW (kDa): 85.47
Preparation method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPK
DGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Molecular Weight (g/mol)	85.47
Preparation Method	In vitro wheat germ expression system
Source	Wheat Germ (in vitro)
Recombinant	Recombinant

Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Cross Reactivity	Human
Form	Solution

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ BTD Recombinant Protein

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ BTD Recombinant Protein

Specifications

Description

Specifications

Documents