missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18245214

Novus Biologicals™ Aspartate Aminotransferase Recombinant Protein Antigen

Artikelnummer. 18245214 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18245214 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18245214 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP257518PEP

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aspartate Aminotransferase. Source: E.coli Amino Acid Sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ The Aspartate Aminotransferase Recombinant Protein Antigen is derived from E. coli. The Aspartate Aminotransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gen-id (Entrez) 2805
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn Aspartate Aminotransferase Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A
Gen symbol GOT1
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μl
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50901. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

For Research Use Only.

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.