missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18235434

Novus Biologicals™ Asparagine synthetase Recombinant Protein Antigen

Artikelnummer. 18235434 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Mængde:
100 μL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18235434

Brand: Novus Biologicals™ NBP256407PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparagine synthetase. Source: E.coli Amino Acid Sequence: MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ The Asparagine synthetase Recombinant Protein Antigen is derived from E. coli. The Asparagine synthetase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 440
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn Asparagine synthetase Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias asparagine synthetase, asparagine synthetase (glutamine-hydrolyzing), asparagine synthetase [glutamine-hydrolyzing], Cell cycle control protein TS11, EC 6.3.5.4, Glutamine-dependent asparagine synthetase, TS11, TS11 cell cycle control protein
Gen symbol ASNS
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μL
Regulatorisk status RUO
Kilde E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50646. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For Research Use Only.

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.