missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18287443

Novus Biologicals™ ASNSD1 Recombinant Protein Antigen

Artikelnummer. 18287443 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18287443 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18287443 Leverandør Novus Biologicals™ Leverandørnr. NBP257925PEP
 Begrænset vare
Forventet forsendelse: 14-10-2026
Læg i indkøbskurv
Læg i indkøbskurv
Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASNSD1. Source: E.coli Amino Acid Sequence: KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE The ASNSD1 Recombinant Protein Antigen is derived from E. coli. The ASNSD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 54529
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn ASNSD1 Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles
Formulering PBS and 1M Urea, pH 7.4
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias asparagine synthetase domain containing 1, asparagine synthetase domain-containing protein 1, HCV NS3-transactivated protein 1, NBLA00058, NS3TP1FLJ20752
Gen symbol ASNSD1
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μl
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53520. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vedi altri risultati Mostra meno risultati

For research use only.

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.