missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Abnova™ ASF1B Recombinant Protein (P01)

Abnova™ ASF1B Recombinant Protein (P01)

Artikelnummer. 16121723
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Pakningsstørrelse:
10µg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16121723

Brand: Abnova™ H00055723P01.10ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Human ASF1B full-length ORF (AAH36521, 1 to 202 a.a.) recombinant protein with GST-tag at N-terminal

This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

  • Theoretical MW (kDa): 47.96
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFGQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPG
LLPENSMDCI

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Tekniske data

Adgangsnummer AAH36521
Til brug med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-id (Entrez) 55723
Molekylvægt (g/mol) 48
Navn ASF1B (Human) Recombinant Protein (P01)
pH-område 8
Fremstillingsmetode In vitro wheat germ expression system
Oprensningsmetode Glutathione Sepharose 4 Fast Flow
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 10 μg
Kilde Wheat Germ (in vitro)
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias CIA-II/FLJ10604
Fælles navn ASF1B
Gen symbol ASF1B
Krydsreaktivitet Human
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Form Solution
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.