missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 18614497

ARSJ Antibody, R&D Systems™

Artikelnummer. 18614497 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18614497 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18614497 Leverandør Novus Biologicals Leverandørnr. NBP248658
  • ONLINE EXCLUSIVE PRICE
    4677.79 DKK
    4042.50 DKK / 0.1ml
    Spare 635.29 DKK
    13% Slukket
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ARSJ Polyclonal antibody specifically detects ARSJ in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ARSJ
Applikationer Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias arylsulfatase family, member J, arylsulfatase J, ASJ, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.12, FLJ23548
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Oprensningsmetode Immunogen affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Lipid and Metabolism
Primær eller sekundær Primary
Gen-id (Entrez) 79642
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.