missing translation for 'onlineSavingsMsg'
Learn More

ARA54 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17686-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310485

  • 2756.95 DKK / 25µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ARA54 Polyclonal antibody specifically detects ARA54 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications

Specifications

ARA54
Polyclonal
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Androgen receptor-associated protein 54, ARA54androgen receptor associated protein 54, EC 6.3.2.-, HFB30E3 ubiquitin-protein ligase RNF14, ring finger protein 14FLJ26004, TRIAD2, Triad2 protein
This antibody was developed against Recombinant Protein corresponding to amino acids: TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL
25 μg
Signal Transduction, Zinc Finger
9604
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions