missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. APPBP2 Antibody, R&D Systems™

APPBP2 Antibody, R&D Systems™

Artikelnummer. 18601974 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18601974 25 μg
18684504 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18601974 Leverandør Novus Biologicals Leverandørnr. NBP32131025ul
  • ONLINE EXCLUSIVE PRICE
    3725.95 DKK
    3199.35 DKK / 25µL
    Spare 526.60 DKK
    14% Slukket
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

APPBP2 Polyclonal specifically detects APPBP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen APPBP2
Applikationer Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulering PBS, pH 7.2, 40% glycerol
Gene Alias amyloid beta precursor protein (cytoplasmic tail) binding protein 2, Amyloid beta precursor protein-binding protein 2, amyloid protein-binding protein 2, APP-BP2, KIAA0228HS.84084, PAT1amyloid beta precursor protein (cytoplasmic tail)-binding protein 2, Protein interacting with APP tail 1
Værtsarter Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
Oprensningsmetode Affinity purified
Mængde 25 μg
Regulatorisk status RUO
Forskningsdisciplin Cancer
Primær eller sekundær Primary
Gen-id (Entrez) 10513
Målarter Human
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.