missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16151696

target of myb1 (chicken), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Artikelnummer. 16151696
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
Pakningsstørrelse:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
16151696 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16151696 Leverandør Abnova Leverandørnr. H00010043D01P.100ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit polyclonal antibody raised against a full-length human TOM1 protein.

This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL

Tekniske data

Antigen target of myb1 (chicken)
Applikationer Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Rabbit polyclonal antibody raised against a full-length human TOM1 protein.
Formulering PBS with no preservative; pH 7.4
Gene TOM1
Genadgangsnr. NM_005488.1
Gene Alias FLJ33404
Gensymboler TOM1
Værtsarter Rabbit
Immunogen TOM1 (NP_005479.1, 1 a.a. ∼ 492 a.a) full-length human protein.
Oprensningsmetode Affinity Purified
Mængde 100 μg
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 10043
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttype Antibody
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.