missing translation for 'onlineSavingsMsg'
Få mere at vide

protein tyrosine phosphatase, receptor type, E, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16133865
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16133865 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16133865 Leverandør Abnova Leverandørnr. H00005791A01.50uL

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Mouse polyclonal antibody raised against a partial recombinant PTPRE.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; Another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokines induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq]

Sequence: WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI

Tekniske data

Antigen protein tyrosine phosphatase, receptor type, E
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Mouse polyclonal antibody raised against a partial recombinant PTPRE.
Formulering 50% glycerol
Gene PTPRE
Genadgangsnr. BC050062
Gene Alias DKFZp313F1310/FLJ57799/FLJ58245/HPTPE/PTPE/R-PTP-EPSILON
Gensymboler PTPRE
Værtsarter Mouse
Immunogen PTPRE (AAH50062, 511 a.a. ∼ 600 a.a) partial recombinant protein with GST tag.
Mængde 50 μL
Regulatorisk status RUO
Hele molekyle Yes
Primær eller sekundær Primary
Gen-id (Entrez) 5791
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.