missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16101385

mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Artikelnummer. 16101385
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
50 μL
Pakningsstørrelse:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
16101385 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16101385 Leverandør Abnova Leverandørnr. H00004436A01.50uL

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse polyclonal antibody raised against a partial recombinant MSH2.

MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. [provided by RefSeq]

Sequence: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT

Tekniske data

Antigen mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Mouse polyclonal antibody raised against a partial recombinant MSH2.
Formulering 50% glycerol
Gene MSH2
Genadgangsnr. BC021566
Gene Alias COCA1/FCC1/HNPCC/HNPCC1/LCFS2
Gensymboler MSH2
Værtsarter Mouse
Immunogen MSH2 (AAH21566, 835 a.a. ∼ 934 a.a) partial recombinant protein with GST tag.
Mængde 50 μL
Regulatorisk status RUO
Hele molekyle Yes
Primær eller sekundær Primary
Gen-id (Entrez) 4436
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.