missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™
Beskrivelse
MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. [provided by RefSeq]
Sequence: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT
Tekniske data
Tekniske data
| Antigen | mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
| Applikationer | ELISA, Western Blot |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
| Oversigt | Mouse polyclonal antibody raised against a partial recombinant MSH2. |
| Formulering | 50% glycerol |
| Gene | MSH2 |
| Genadgangsnr. | BC021566 |
| Gene Alias | COCA1/FCC1/HNPCC/HNPCC1/LCFS2 |
| Gensymboler | MSH2 |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?