missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16190295

eukaryotic translation initiation factor 6, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16190295
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16190295 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16190295 Leverandør Abnova Leverandørnr. H00003692A01.50uL

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Tekniske data

Antigen eukaryotic translation initiation factor 6
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.
Formulering 50% glycerol
Gene EIF6
Genadgangsnr. NM_002212
Gene Alias 2/CAB/EIF3A/ITGB4BP/b/b(2)gcn/gcn/p27BBP
Gensymboler EIF6
Værtsarter Mouse
Immunogen ITGB4BP (NP_002203, 146 a.a. ∼ 245 a.a) partial recombinant protein with GST tag.
Mængde 50 μL
Regulatorisk status RUO
Hele molekyle Yes
Primær eller sekundær Primary
Gen-id (Entrez) 3692
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.