missing translation for 'onlineSavingsMsg'
Learn More

inner membrane protein, mitochondrial (mitofilin), Mouse, Polyclonal Antibody, Abnova™

Name: inner membrane protein, mitochondrial (mitofilin), Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16143486
Price: 1800.00 EUR

Mouse polyclonal antibody raised against a partial recombinant IMMT.

Brand: Abnova H00010989-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16143486

1800.00 DKK / 50µL

Estimated Shipment: 17-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM

Specifications

Antigen	inner membrane protein, mitochondrial (mitofilin)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant IMMT.
Gene	IMMT
Gene Alias	DKFZp779P1653/HMP/MGC111146/P87/P87/89/P89/PIG4/PIG52
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	10989
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_006839
Gene Symbols	IMMT
Immunogen	IMMT (NP_006830, 481 a.a. ∼ 580 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

inner membrane protein, mitochondrial (mitofilin), Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Special Offers