missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16188494

GAPDH, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16188494
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16188494 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16188494 Leverandør Abnova Leverandørnr. H00002597A01.50uL
  • ONLINE EXCLUSIVE PRICE
    2095.00 DKK
    2011.89 DKK / 50µL
    Spare 83.11 DKK
    3% Slukket
 Begrænset vare
Forventet forsendelse: 22-01-2027
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse polyclonal antibody raised against a partial recombinant GAPDH.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq

Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Tekniske data

Antigen GAPDH
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Mouse polyclonal antibody raised against a partial recombinant GAPDH.
Formulering 50% glycerol
Gene GAPDH
Genadgangsnr. NM_002046
Gene Alias G3PD/GAPD/MGC88685
Gensymboler GAPDH
Værtsarter Mouse
Immunogen GAPDH (NP_002037, 226 a.a. ∼ 335 a.a) partial recombinant protein with GST tag.
Mængde 50 μL
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 2597
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttype Antibody
Form Liquid
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.