missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16108292

FGF21, Mouse, Clone: 1A8, Abnova™

Artikelnummer. 16108292
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
100 μg
Pakningsstørrelse:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
16108292 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16108292 Leverandør Abnova Leverandørnr. H00026291M02.100ug
  • ONLINE EXCLUSIVE PRICE
    3030.00 DKK
    2908.86 DKK / 100µg
    Spare 121.14 DKK
    3% Slukket
 Begrænset vare
Forventet forsendelse: 27-01-2027
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse monoclonal antibody raised against a full-length recombinant FGF21.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Tekniske data

Antigen FGF21
Applikationer ELISA, Immunoprecipitation, Western Blot
Klassifikation Monoclonal
Klon 1A8
Konjugeret Unconjugated
Oversigt Mouse monoclonal antibody raised against a full length recombinant FGF21.
Formulering PBS with no preservative; pH 7.4
Gene FGF21
Genadgangsnr. BC018404
Gensymboler FGF21
Værtsarter Mouse
Immunogen FGF21 (AAH18404, 30 a.a. ∼ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Oprensningsmetode Unpurified
Mængde 100 μg
Regulatorisk status RUO
Primær eller sekundær Primary
Gen-id (Entrez) 26291
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttype Antibody
Isotype IgG1 κ
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.