missing translation for 'onlineSavingsMsg'
Learn More

epithelial membrane protein 1, Mouse, Polyclonal Antibody, Abnova™

Name: epithelial membrane protein 1, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16104501
Price: 1800.00 EUR

Mouse polyclonal antibody raised against a full-length recombinant EMP1.

Brand: Abnova H00002012-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16104501

1800.00 DKK / 50µL

Estimated Shipment: 16-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Specifications

Antigen	epithelial membrane protein 1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a full-length recombinant EMP1.
Gene	EMP1
Gene Alias	CL-20/EMP-1/TMP
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	2012
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	BC047300
Gene Symbols	EMP1
Immunogen	EMP1 (AAH47300, 1 a.a. ∼ 157 a.a) full-length recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

epithelial membrane protein 1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Special Offers