missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16178222

C-type lectin domain family 4, member E, Mouse, Clone: 2F2, Abnova™

Artikelnummer. 16178222
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16178222 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16178222 Leverandør Abnova Leverandørnr. H00026253M01A.200uL

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse monoclonal antibody raised against a full-length recombinant CLEC4E.

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq

Sequence: MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Tekniske data

Antigen C-type lectin domain family 4, member E
Applikationer ELISA, Western Blot
Klassifikation Monoclonal
Klon 2F2
Konjugeret Unconjugated
Oversigt Mouse monoclonal antibody raised against a full length recombinant CLEC4E.
Formulering ascites with no preservative
Gene CLEC4E
Genadgangsnr. BC000715
Gene Alias CLECSF9/MINCLE
Gensymboler CLEC4E
Værtsarter Mouse
Immunogen CLEC4E (AAH00715, 1 a.a. ∼ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Mængde 200 μL
Regulatorisk status RUO
Hele molekyle Yes
Primær eller sekundær Primary
Gen-id (Entrez) 26253
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttype Antibody
Form Ascites
Isotype IgM κ
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.