missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 16143956

carbonic anhydrase VB, mitochondrial (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Artikelnummer. 16143956
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
16143956 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 16143956 Leverandør Abnova Leverandørnr. H00011238A01.50uL

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse polyclonal antibody raised against a partial recombinant CA5B.

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles. [provided by RefSeq

Sequence: VVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPA

Tekniske data

Antigen carbonic anhydrase VB, mitochondrial
Applikationer ELISA, Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Oversigt Mouse polyclonal antibody raised against a partial recombinant CA5B.
Formulering 50% glycerol
Gene CA5B
Genadgangsnr. NM_007220
Gene Alias CA-VB/MGC39962
Gensymboler CA5B
Værtsarter Mouse
Immunogen CA5B (NP_009151, 2 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
Mængde 50 μL
Regulatorisk status RUO
Forskningsdisciplin Endocrine/Metabolism
Hele molekyle Yes
Primær eller sekundær Primary
Gen-id (Entrez) 11238
Målarter Human
Indhold og opbevaring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.