missing translation for 'onlineSavingsMsg'
Learn More

membrane-associated ring finger (C3HC4) 6, Mouse, Polyclonal Antibody, Abnova™

Name: membrane-associated ring finger (C3HC4) 6, Mouse, Polyclonal Antibody, Abnova&trade;
Brand: Abnova
SKU: 16102326
Price: 1800.00 EUR

Mouse polyclonal antibody raised against a partial recombinant MARCH6.

Brand: Abnova H00010299-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16102326

1800.00 DKK / 50µL

Estimated Shipment: 16-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR

Specifications

Antigen	membrane-associated ring finger (C3HC4) 6
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant MARCH6.
Gene	MARCH6
Gene Alias	KIAA0597/MARCH-VI/RNF176/TEB4
Host Species	Mouse
Quantity	50 μL
Research Discipline	Ubiquitin/Proteasome
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_005885
Gene Symbols	MARCH6
Immunogen	40974 (NP_005876, 2 a.a. ∼ 91 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	10299
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

membrane-associated ring finger (C3HC4) 6, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Special Offers