missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Rekombinante proteiner
  4. Abnova™ ANGPTL3 Recombinant Protein

Abnova™ ANGPTL3 Recombinant Protein

Artikelnummer. 16178782
Klik for at se tilgængelige muligheder
Mængde:
10 μg
25 μg
Pakningsstørrelse:
25µg
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 16178782

Brand: Abnova™ H00027329P01.25ug

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Human ANGPTL3 full-length ORF recombinant protein with GST-tag at N-terminal

The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may also play a role in the regulation of angiogenesis.

  • Theoretical MW (kDa): 74.58
  • Preparation method: In vitro wheat germ expression system
  • Purification: Glutathione Sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQE
PTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Tekniske data

Adgangsnummer AAH58287
Til brug med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-id (Entrez) 27329
Molekylvægt (g/mol) 74.58
Navn ANGPTL3 (Human) Recombinant Protein (P01)
pH-område 8
Fremstillingsmetode In vitro wheat germ expression system
Oprensningsmetode Glutathione Sepharose 4 Fast Flow
Kvalitetskontrol test 12.5% SDS-PAGE Stained with Coomassie Blue.
Mængde 25 μg
Kilde Wheat Germ (in vitro)
Opbevaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias ANGPT5
Fælles navn ANGPTL3
Gen symbol ANGPTL3
Krydsreaktivitet Human
Arter Wheat Germ (in vitro)
Rekombinant Recombinant
Protein tag GST
Form Solution
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.