Learn More
Abnova™ ANGPTL1 Recombinant Protein
Human full-length ORF recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00009068-P01.25ug
Description
- Encoded by angiopoietin-like 1 gene
- Molecular weight: 77.22kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPP
LVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH50640 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
77.22 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ANGPTL1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, Protein Array, ELISA, Western Blot | |
9068 | |
ANGPTL1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
ANG3/ANGPT3/ARP1/AngY/KIAA0351/UNQ162/dJ595C2.2 | |
ANGPTL1 | |
Wheat Germ (in vitro) | |
GST |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.