missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ANAPC15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
4035.00 DKK
Tekniske data
| Antigen | C11orf51 |
|---|---|
| Fortynding | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applikationer | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugeret | Unconjugated |
Beskrivelse
ANAPC15 Polyclonal specifically detects ANAPC15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Tekniske data
| C11orf51 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 25906 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| anaphase promoting complex subunit 15, APC15, C11orf51, chromosome 11 open reading frame 51, DKFZP564M082, HSPC020, hypothetical protein LOC25906 | |
| ANAPC15 | |
| IgG | |
| Affinity Purified | |
| Specificity of human ANAPC15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel