missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. AlphaB Crystallin/CRYAB Antibody, R&D Systems™

AlphaB Crystallin/CRYAB Antibody, R&D Systems™

Artikelnummer. 18603409 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18603409 0.1 mL 0.1ml
18649696 25 μL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18603409 Leverandør Novus Biologicals Leverandørnr. NBP249246
 Begrænset vare
Forventet forsendelse: 01-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

AlphaB Crystallin/CRYAB Polyclonal antibody specifically detects AlphaB Crystallin/CRYAB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen AlphaB Crystallin/CRYAB
Applikationer Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulering PBS (pH 7.2), 40% Glycerol
Gene Alias alpha B crystallin, alpha(B)-crystallin, alpha-crystallin B chain, CRYA2alpha crystallin B chain, crystallin, alpha B, CTPP2, Heat shock protein beta-5, heat-shock 20 kD like-protein, HSPB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component
Værtsarter Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Oprensningsmetode Immunogen affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cancer, Cell Biology, Cell Cycle and Replication, Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience, Neurotransmission, Protein Phosphatase, Sensory Systems, Signal Transduction, Tyrosine Kinases, Vision
Primær eller sekundær Primary
Gen-id (Entrez) 1410
Målarter Human
Indhold og opbevaring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.