missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ AKR1C2 (Human) Recombinant Protein
Human AKR1C2 full-length ORF ( AAH07024, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
2735.00 DKK - 4145.00 DKK
Specifications
Accession Number | AAH07024 |
---|---|
Gene ID (Entrez) | 1646 |
Name | aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) |
Preparation Method | Wheat germ expression system |
Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16137104
|
Abnova™
H00001646-P01.10ug |
10 ÎĽg |
2735.00 DKK
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
16147104
|
Abnova™
H00001646-P01.25ug |
25 ÎĽg |
4145.00 DKK
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
- Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Specifications
AAH07024 | |
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) | |
125% SDS-PAGE Stained with Coomassie Blue | |
AKR1C-pseudo, BABP, DD, DD2, DDH2, HAKRD, HBAB, MCDR2 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
1646 | |
Wheat germ expression system | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
AKR1C2 | |
GST |
Safety and Handling
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ AKR1C2 (Human) Recombinant Protein