missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2L1. Source: E.coli Amino Acid Sequence: LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA The AGXT2L1 Recombinant Protein Antigen is derived from E. coli. The AGXT2L1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Tekniske data
Tekniske data
| Gen-id (Entrez) | 64850 |
| Oprensningsmetode | >80% by SDS-PAGE and Coomassie blue staining |
| Fælles navn | AGXT2L1 Recombinant Protein Antigen |
| Indhold og opbevaring | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulering | PBS and 1M Urea, pH 7.4. |
| Til brug med (applikation) | Blocking/Neutralizing, Control |
| Gene Alias | alanine--glyoxylate aminotransferase 2-like 1, alanine-glyoxylate aminotransferase 2-like 1, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.44 |
| Gen symbol | AGXT2L1 |
| Etikettype | Unlabeled |
| Produkttype | Recombinant Protein Antigen |
| Vis mere |
For Research Use Only.
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?