missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. 18258082

Novus Biologicals™ AGXT2L1 Recombinant Protein Antigen

Artikelnummer. 18258082 Shop alle Bio Techne produkter
Change view
Click to view available options
Mængde:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Mængde
18258082 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18258082 Supplier Novus Biologicals™ Supplier No. NBP257397PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGXT2L1. Source: E.coli Amino Acid Sequence: LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSA The AGXT2L1 Recombinant Protein Antigen is derived from E. coli. The AGXT2L1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gen-id (Entrez) 64850
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn AGXT2L1 Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
Til brug med (applikation) Blocking/Neutralizing, Control
Gene Alias alanine--glyoxylate aminotransferase 2-like 1, alanine-glyoxylate aminotransferase 2-like 1, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.44
Gen symbol AGXT2L1
Etikettype Unlabeled
Produkttype Recombinant Protein Antigen
Mængde 100 μl
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50907. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.