missing translation for 'onlineSavingsMsg'
Learn More

AGPAT5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17797-25UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310636

  • 2756.95 DKK / 25µL
Estimated Shipment: 25-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

AGPAT5 Polyclonal antibody specifically detects AGPAT5 in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

AGPAT5
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acidacyltransferase, epsilon), 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon, 1-AGPAT 5,1-acylglycerol-3-phosphate O-acyltransferase 5, 1AGPAT5,1-AGP acyltransferase 5, EC 2.3.1.51, FLJ11210, LPAAT-e, LPAATE, LPAAT-epsilon, Lysophosphatidic acid acyltransferase epsilon
This antibody was developed against Recombinant Protein corresponding to amino acids: ANHQSTVDWIVADILAIRQNALGHVRYVLKEGLKWLPLYGCYFAQHGGIYVKRSAKFNEKEMRNKLQSYVDAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQRGLAVLKHVLTPRIK
25 μg
Lipid and Metabolism
55326
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers