missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. ADCK4 Antibody, R&D Systems™

ADCK4 Antibody, R&D Systems™

Artikelnummer. 18229746 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde
18229746 0.1 mL
18467091 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18229746 Leverandør Novus Biologicals Leverandørnr. NBP185508
  • ONLINE EXCLUSIVE PRICE
    4677.79 DKK
    4042.50 DKK / 0.1ml
    Spare 635.29 DKK
    13% Slukket
 Begrænset vare
Forventet forsendelse: 02-12-2026
Læg i indkøbskurv
Læg i indkøbskurv

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ADCK4 Polyclonal specifically detects ADCK4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ADCK4
Applikationer Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias aarF domain containing kinase 4, COQ8, EC 2.7.11, EC 2.7.11.-, EC 2.7.11.1, EC 2.7.11.25, FLJ12229
Gensymboler COQ8B
Værtsarter Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
Oprensningsmetode Affinity Purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Protein Kinase
Primær eller sekundær Primary
Gen-id (Entrez) 79934
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttype Antibody
Isotype IgG
Produktlinje Novus
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.