missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. 30498745

ACSL3 Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™

Artikelnummer. 30498745 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.1 mL
Pakningsstørrelse:
0.1ml
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde unitSize
30498745 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 30498745 Leverandør Novus Biologicals Leverandørnr. NBP335183MFV610

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

ACSL3 Polyclonal antibody specifically detects ACSL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ACSL3
Applikationer ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugeret mFluor Violet 610 SE
Formulering 50mM Sodium Borate
Gene Alias ACS3EC 6.2.1.3, acyl-CoA synthetase long-chain family member 3, FACL3lignoceroyl-CoA synthase, fatty-acid-Coenzyme A ligase, long-chain 3, LACS 3, LACS3, Long-chain acyl-CoA synthetase 3, long-chain-fatty-acid--CoA ligase 3, PRO2194
Værtsarter Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 621-720 of human ACSL3 (NP_004448.2).,, Sequence:, VIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Lipid and Metabolism
Primær eller sekundær Primary
Gen-id (Entrez) 2181
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at 4°C in the dark.
Produkttype Antibody
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.