missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antistoffer
  4. Primære antistoffer
  5. Alle primære antistoffer
  6. ABCG4 Antibody - Azide and BSA Free, R&D Systems™

ABCG4 Antibody - Azide and BSA Free, R&D Systems™

Artikelnummer. 18605011 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Mængde:
0.02 mL
0.1 mL
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Mængde Pakningsstørrelse
18605011 0.1 mL 0.1ml
18675571 0.02 mL -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18605011 Leverandør Novus Biologicals Leverandørnr. NBP2921740.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternative produkter

missing translation for 'validMainframeMsg'

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ABCG4 Polyclonal antibody specifically detects ABCG4 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ABCG4
Applikationer Western Blot
Klassifikation Polyclonal
Konjugeret Unconjugated
Fortynding Western Blot 1:500-1:2000
Formulering PBS with 50% glycerol, pH7.3.
Gene Alias ATP-binding cassette, sub-family G (WHITE), member 4, ATP-binding cassette, subfamily G, member 4, putative ABC transporter, WHITE2ATP-binding cassette sub-family G member 4
Værtsarter Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human ABCG4 (NP_071452.2). KLYILSQGQCIFKGVVTNLIPYLKGLGLHCPTYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST
Oprensningsmetode Affinity purified
Mængde 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin ABC Transporters, Lipid and Metabolism
Primær eller sekundær Primary
Gen-id (Entrez) 64137
Målarter Human, Mouse, Rat
Indhold og opbevaring Store at -20°C. Avoid freeze-thaw cycles.
Produkttype Antibody
Form Purified
Isotype IgG
Produktlinje Novus
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.