missing translation for 'onlineSavingsMsg'
Learn More

AATF Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17680-100UL

Additional Details : Weight : 0.00970kg

 View more versions of this product

Product Code. 18310696

  • 4398.37 DKK / 100µL
Estimated Shipment: 27-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

AATF Polyclonal antibody specifically detects AATF in Human samples. It is validated for Immunofluorescence
Specifications

Specifications

AATF
Polyclonal
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
apoptosis antagonizing transcription factor, Apoptosis-antagonizing transcription factor, CHE-1, CHE1Rb-binding protein Che-1, DEDprotein AATF
This antibody was developed against Recombinant Protein corresponding to amino acids: ELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKG
100 μg
Apoptosis
26574
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
IgG
Immunofluorescence
Unconjugated
PBS, pH 7.2, 40% glycerol
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers