missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biokemiske reagenser
  4. Peptider
  5. Novus Biologicals™ 53BP1 Recombinant Protein Antigen

Novus Biologicals™ 53BP1 Recombinant Protein Antigen

Artikelnummer. 18206754 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Protein længde:
AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL
VPSPATRSEALSVLDQEEAMEIKEHHPEEGSSGSVEEIPETPESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA
Pakningsstørrelse:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Protein længde unitSize
18206754 AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL 0.1ml
18264054 VPSPATRSEALSVLDQEEAMEIKEHHPEEGSSGSVEEIPETPESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLA -
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18206754 Leverandør Novus Biologicals™ Leverandørnr. NBP254659PEP

Venligst for at købe denne vare. Brug for en webkonto? Register dig hos os i dag!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human 53BP1 The 53BP1 Recombinant Protein Antigen is derived from E. coli. The 53BP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gen-id (Entrez) 7158
Protein længde AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL
Oprensningsmetode >80% by SDS-PAGE and Coomassie blue staining
Fælles navn 53BP1 Recombinant Protein Antigen
Indhold og opbevaring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4
Til brug med (applikation) PAGE
Gene Alias 53BP1, MGC138366, p202
Gen symbol TP53BP1
Etikettype Unlabeled
Molekylvægt (g/mol) 33 kDa
Produkttype Recombinant Protein Antigen
Mængde 0.1 mL
Regulatorisk status RUO
Kilde E.coli
Specifik reaktivitet Human
Vis mere Vis mindre

For Research Use Only.

Produkttitel
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.